PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_77219_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 112aa    MW: 13012 Da    PI: 11.1583
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_77219_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.1e-106351948
                                         TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +G g W++ ar  g++Rt+k+c++rw++yl
  cra_locus_77219_iso_1_len_332_ver_3  6 HGEGVWNSLARSAGLKRTGKSCRLRWLNYL 35
                                         999**************************7 PP

2Myb_DNA-binding55.71.2e-174184146
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
  cra_locus_77219_iso_1_len_332_ver_3 41 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 84
                                         8999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.283135IPR017930Myb domain
SMARTSM0071730237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-14542IPR009057Homeodomain-like
CDDcd001673.08E-4635No hitNo description
PfamPF002498.5E-8635IPR001005SANT/Myb domain
SuperFamilySSF466895.01E-232193IPR009057Homeodomain-like
PROSITE profilePS5129424.8313690IPR017930Myb domain
SMARTSM007173.4E-154088IPR001005SANT/Myb domain
PfamPF002491.2E-164184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-254391IPR009057Homeodomain-like
CDDcd001678.33E-124584No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
XGRGNHGEGV WNSLARSAGL KRTGKSCRLR WLNYLRPDVR RGNITPEEQL LIMELHAKWG  60
NRWSKIAKHL PGRTDNEIKN FWRTRIQKHM KQGDDSNFNG QNDNHSNDQA SX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1869025108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468270.17e-66PREDICTED: myb-related protein 305-like
SwissprotP813911e-63MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A068U0Q27e-65A0A068U0Q2_COFCA; Uncharacterized protein
TrEMBLA0A0K0MAN29e-65A0A0K0MAN2_FRAAN; Emission of benzenoids II protein
STRINGfgenesh1_pm.C_scaffold_50004452e-60(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154